-
- Brandy glass jar
- Model Number: KB1517 Brand Name: D&O Key Specifications/Special Features: Brandy glass jarSize: D15*H17cm, other different size availableMaterial: normal glass, from electric furnaceBright clearColor spray is availablePack: 1pc/brown box, ...
Qingdao D&O Houseware Co. Ltd [Verified]
-
- Oem specially design Aquarium decorations
- Model Number: Aquarium decorations-A0WZ Brand Name: jiaxing Key Specifications/Special Features: Material:ResinSize:Customizedcolor:Customizedquality:besteco-friendly:yesPacking: customizedOEM orders are welcomeT/T, L/C, PayPal Ship...
Jinjiang Jiaxing Company [Verified]
-
- TV Promotional Pet Products Recycle Crystal Color Fish Tank
- Model Number: Fish Tank-#DH07 Brand Name: YK Key Specifications/Special Features: Material: PS+TPRWeight: 640gSize: 143x105x255mmMy fun fish the aquarium that cleans itself like magic, just add clean water and the dirty water flows out the clean...
Ningbo Younker Fashion Accessory Industrial Corp. [Verified]
-
- Mini fish tank, acrylic material
- Model Number: yg1-#2113 Brand Name: Fuguanda Key Specifications/Special Features: Productdetails:AcrylicrawmaterialAllshapesareaccepted,round,square,oval,rectangular,uniqueSmalltrialorderisacceptedSpecializinginOEM,ODMordersHarmless,environment-...
Fuguanda Acrylic Crafts Factory [Verified]
-
- Magnesium chloride, refined aquarium additive
- Model Number: Magnesium Chloride-81 Key Specifications/Special Features: Product name: magnesium chlorideOther names: magnesium saltPurity: 99%minAppearance: whiteCAS no: 7786-30-3EINECS no: 232-094-6Certificate: ISO 9001Place of origin: Luoyang...
Henan Shengtian Metal Material Co.,Ltd [Verified]
-
- Portable 220V Rechargeable Mini Air Pump
- Model Number: S-OG-3433 Key Specifications/Special Features: 1) Mini air pump2) Used as oxygenating device for fish tank and aquarium, especially useful for emergency time3) With built-in battery, suitable for indoor and outdoor uses4) Chargin...
Shenzhen Sunsky Technology Limited [Verified]
-
- Washing natural aquarium landscaping stone
- Model Number: ZXA-71 Brand Name: zongxiao Key Specifications/Special Features: Our company supplies various kinds of stone for aquarium and gardenAquarium rock ZXA-061. Shape: natural shape such as mountain, surface drape2. Material: natural s...
SHIJIAZHUANG ZONGXIAO TRADING CO.,LTD [Verified]
-
- Hot new products customize plastic fish tank, aquarium with LED light
- Model Number: WB-007 aquarium fish tank-014 Brand Name: Yake Key Specifications/Special Features: Aquarium and accessory type: aquariumsFeatures: eco-friendly, stockedPlace of origin: Guangdong, China (Mainland)Brand name: YKModel number: WB-0...
Xiongyihua Plastic Limited [Verified]
-
- High Quality Floating Fish Feed Pellet for Catfish
- Model Number: animal feed Brand Name: yatai Key Specifications/Special Features: Directions for Use1.Accordingtogrowthcycledeterminefeedingfeedtype,inordertomeetthecatfishdifferentgrowthstagesofnutritionalrequirements.2.Do"timing,point,quantitat...
Cangzhou Yatai Commercial & Trade Co . Ltd [Verified]
-
- Hot Sale beautiful round shape acrylic fish tank cheap price With 100% virgin PMMA material
- Model Number: SSYG-023-1 Brand Name: sunsee Key Specifications/Special Features: Specifications:1. Wholesale2. Top grade acrylic3. Environment-friendly4. Very fashionable and beautiful5. Excellent weather fastPacking:EPE, polybag, paper carton, ...
Ningbo Sunsee Acrylic Industry Co. Ltd [Verified]
-
- Water Pump for Pond Swimming Pool DC for Solar or Submersible Pumping System
- Model Number: ZDB35-1 Brand Name: GORDON Key Specifications/Special Features: Pump:>>Pump body: cast iron and supports under special anti-rust treatment>>Impeller: stainless steel impeller, brass impeller, PPO impeller>>Mechani...
Fujian Gordon Pump Industry Co. Ltd [Verified]
-
- Pump Station
- Model Number: ZLB/Q-1 Brand Name: Fuchun Key Specifications/Special Features: Type ZLB/Q pumps are single-stage vertical axial flow pumps. Type HLB/Q mixed flow pump was high efficiency, good anti-cavitation’s performance. They are provided for ...
Fuchun Industry Development Co. Ltd Shenzhen China [Verified]
-
- Manual Water Pump, Made of Food Grade Plastic, Measuring 120 x 120 x 240mm
- Model Number: SWP-1(A) Brand Name: SIGMA Key Specifications/Special Features: Manual water pumpMaterial: food grade plasticIt's easy to use gallon water via using water pumpEconomical, low cost, and easy water dispenserProduct dimensions: 120 ...
Wenzhou Success Group Co. Ltd [Verified]
-
- Aquarium natural rock decorations,
- Model Number: ZXA-07-#8439 Brand Name: zongxiao Key Specifications/Special Features: Ourcompany supply various kind of stone for aqarium and gardenAquarium rockShape: natural shapeMaterial: natural stoneColor: grey and back with white lineSizes:...
SHIJIAZHUANG ZONGXIAO TRADING CO.,LTD [Verified]
-
- 100% new material factory low price eye-catching curved square shape glass fish bowl for sale
- Model Number: SSYG-017 Brand Name: sunsee Key Specifications/Special Features: Specifications:1. Wholesale2. Top grade acrylic3. Environment-friendly4. Very fashionable and beautiful5. Excellent weather fastPacking:EPE, polybag, paper carton, wo...
Ningbo Sunsee Acrylic Industry Co. Ltd [Verified]
-
- Magnesium chloride, anhydrous road salt for sale
- Model Number: Magnesium Chloride-92 Key Specifications/Special Features: Product name: magnesium chlorideOther names: magnesium saltPurity: 99%minAppearance: whiteCAS number: 7786-30-3EINECS number: 232-094-6Certifications: ISO 9001Place of orig...
Henan Shengtian Metal Material Co.,Ltd [Verified]
-
- Large capacity plastic fish bowl, beautiful appearance, plastic design
- Model Number: WY029 Key Specifications/Special Features: Size: 4.2LMaterial: PETWeight:172gOEM/ODM: yesPacking: OPP bagWelcome you to check and inquireWe will try best to offer you the best service and high-quality goods. Shipping I...
Wuxi Xinya Micro Fibrous Co. Ltd [Verified]
-
- IP65 waterproof 115cm 36x3w 108W LED aquarium bar light with aluminum housing
- Model Number: HLX-115CM-36*3W-BW Brand Name: HLX Key Specifications/Special Features: Product advantages:1. Full spectrum: White 10000K,green 520nm, blue 470nm, UV 430nm. Customize available.2. The color ratio can be customized according to your...
HongLang Co.,Ltd [Verified]
-
- Fish Feed 36%
- Model Number: Fish feed 36% protein Brand Name: YATAI Key Specifications/Special Features: Fish Feed 36%Specifications:Protein: 36% minMoisture: 10% maxAsh: 10% maxFat: 7-8%Fiber: 4% maxLysine: 1.2% minPhosphorous: 0.8% minMethionine: 0.4% minSi...
Cangzhou Yatai Commercial & Trade Co . Ltd [Verified]
-
- Red and white stripes aquarium stone ornament
- Model Number: ZXA-46-#2369 Brand Name: zongxiao Key Specifications/Special Features: Our company supplies various kinds of stone for aquarium and gardenAquarium rock1. Shape: natural shape.2. Material: natural stone3. Color: Red and white stri...
SHIJIAZHUANG ZONGXIAO TRADING CO.,LTD [Verified]
Top Search This Week
New Products
-
Bellows with Outer Braid
price: Negotiable
-
DNV Steel Plate
price: Negotiable
-
Clear Tile Protection Film
price: Negotiable